PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc060836.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 106aa    MW: 11476.9 Da    PI: 8.7244
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc060836.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR131.27.1e-105090142
                     FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42
                             +fY +YA++ GF+vr s+ k+  rngei++r +vCs++g r 
  Itr_sc060836.1_g00001.1 50 QFYMSYARSGGFDVRHSTVKRG-RNGEIVMRYLVCSRQGLRG 90
                             6****************99887.8999************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.9E-75089IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
ESLWGSSYGG GEHGGMELST IAPEFWTPSV DESLLPFVGC RFQTLTAGIQ FYMSYARSGG  60
FDVRHSTVKR GRNGEIVMRY LVCSRQGLRG GGRSKPTPVL GDKGGE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.18e-08FAR1-related sequence 7